PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vang03g14410.1
Common NameLR48_Vigan09g095300
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family NF-YB
Protein Properties Length: 183aa    MW: 20128 Da    PI: 5.669
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vang03g14410.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB104.86e-33797696
           NF-YB  6 rflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelege 96
                      +Pi+nv++im+k lP+ ak+s+ ake++q  ++++i+ vt +a +kcq e rk +n+ddllwa+ ++Gf++y+ pl+++l++ r++eg+
  Vang03g14410.1  7 SKMPITNVTKIMRKFLPNTAKVSDGAKEMIQLSATNYITHVTRKAKEKCQSEYRKIMNADDLLWAIENVGFDEYIGPLSTFLQRCRHFEGA 97
                    579*************************************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.104.2E-29598IPR009072Histone-fold
PfamPF008087.9E-17872IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
SuperFamilySSF471133.24E-23898IPR009072Histone-fold
PRINTSPR006152.1E-53654No hitNo description
PRINTSPR006152.1E-55573No hitNo description
PRINTSPR006152.1E-57492No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 183 aa     Download sequence    Send to blast
LIGRDKSKMP ITNVTKIMRK FLPNTAKVSD GAKEMIQLSA TNYITHVTRK AKEKCQSEYR  60
KIMNADDLLW AIENVGFDEY IGPLSTFLQR CRHFEGASAN GPAFGPTFGP DLNPLEMPHP  120
PLPPPPPPPP PPVVCSSGLD FSMQQNTIFD PNDVSGYLDG VGCSNNAFIN FDPFSLFQQD  180
QL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1n1j_A9e-21993993NF-YB
4csr_A9e-219931094NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
4awl_B9e-219931094NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150380.0AP015038.1 Vigna angularis var. angularis DNA, chromosome 5, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014523250.11e-100PREDICTED: nuclear transcription factor Y subunit B-1-like
TrEMBLA0A0L9VCA81e-134A0A0L9VCA8_PHAAN; Uncharacterized protein
TrEMBLA0A0S3S6L31e-134A0A0S3S6L3_PHAAN; Uncharacterized protein
STRINGGLYMA07G29695.15e-42(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF59134150
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G21970.12e-29NF-YB family protein
Publications ? help Back to Top
  1. Yang K, et al.
    Genome sequencing of adzuki bean (Vigna angularis) provides insight into high starch and low fat accumulation and domestication.
    Proc. Natl. Acad. Sci. U.S.A., 2015. 112(43): p. 13213-8
    [PMID:26460024]